PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21736.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 309aa    MW: 34780.2 Da    PI: 7.754
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21736.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.6e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd+ lvd+++++G g+W++ +++ g+ R++k+c++rw +yl
       KHN21736.1 14 RGAWTPEEDQSLVDYIHKHGHGSWRSLPKHAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding54.23.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+  +v+++ +lG++ W++Ia+ ++ gRt++++k++w+++l
       KHN21736.1  67 RGPFTSEEESTIVQLHGMLGNR-WASIASQLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.496961IPR017930Myb domain
SuperFamilySSF466891.5E-3011108IPR009057Homeodomain-like
SMARTSM007179.9E-141363IPR001005SANT/Myb domain
PfamPF002498.9E-181461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-241568IPR009057Homeodomain-like
CDDcd001672.32E-111661No hitNo description
PROSITE profilePS5129425.7662116IPR017930Myb domain
SMARTSM007173.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.4E-1567112IPR001005SANT/Myb domain
CDDcd001675.69E-1169112No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGKAPCCEKH GVRRGAWTPE EDQSLVDYIH KHGHGSWRSL PKHAGLLRCG KSCRLRWINY  60
LRPGIKRGPF TSEEESTIVQ LHGMLGNRWA SIASQLPGRT DNEIKNYWNT HLKKRLLRSC  120
YSQRAKQLCV IPDPTIVKSE SPSTRHMVQW ESVRVEAEAR LSMESTMLNS WPTSKTCPDH  180
FLQLWNSEVG KSFRMIKGKE EGVVSQSLVS QPSSSSKLES CSDVSLQVKN NTGNSSCIPK  240
LEDVSMVHEQ TSSYKPKLDD DTAGSDSGNY EFLDTSDSTL KHLLHMPDSD MGFLGQNDHF  300
QNLLDGTCD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
1h8a_C3e-281411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352300.0AC235230.1 Glycine max strain Williams 82 clone GM_WBb0026I18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535618.10.0PREDICTED: transcription factor MYB3-like
RefseqXP_006589547.10.0PREDICTED: transcription factor MYB3-like
TrEMBLA0A0B2QK180.0A0A0B2QK18_GLYSO; Myb-related protein Myb4
TrEMBLK7LL350.0K7LL35_SOYBN; Uncharacterized protein
STRINGGLYMA10G38090.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-89myb domain protein 17
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]